PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr2g088730.1
Common NameMTR_2g088730
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 82aa    MW: 9068.99 Da    PI: 4.7773
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr2g088730.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.42.8e-123273245
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                       ++++E++l+++ +k+ G + W +Ia +++ gRt++++k++w 
  Medtr2g088730.1 32 VEFSKDEEDLIIRMHKLVGDR-WPLIAGRIP-GRTAEEIKNYWI 73
                     679****************99.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.0472680IPR017930Myb domain
SMARTSM007178.8E-113078IPR001005SANT/Myb domain
PfamPF002493.9E-113273IPR001005SANT/Myb domain
CDDcd001675.51E-103372No hitNo description
Gene3DG3DSA:1.10.10.602.1E-153374IPR009057Homeodomain-like
SuperFamilySSF466891.72E-103375IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 82 aa     Download sequence    Send to blast
MDNVECSSEE VSSDSSIALQ SNSSGTQVNS KVEFSKDEED LIIRMHKLVG DRWPLIAGRI  60
PGRTAEEIKN YWISRHSSTS Q*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003597019.11e-53myb transcription factor
SwissprotO220593e-19CPC_ARATH; Transcription factor CPC
TrEMBLG7IKK01e-53G7IKK0_MEDTR; Myb transcription factor
STRINGGLYMA12G32130.34e-25(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26923178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01060.19e-21CAPRICE-like MYB3
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]